PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00004051-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 549aa    MW: 60875.6 Da    PI: 4.3346
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00004051-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2253.7e-691695471374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l +lL++cAea+s+g + la+ +L+rl+ l+sp+g++m+R+a y+ +AL    + ++ +  +    s   ++  ++ l alkl++ + P++++
  PSME_00004051-RA 169 LLHLLTACAEAISEGAQDLAEVILCRLRGLVSPTGSTMERVAYYLFNALVCSNNMNSIGHLEPNDRSMRITSAKEHFLGALKLLHVAYPYIRI 261
                       579**********************************************75544422222333333333334477889999************ PP

              GRAS  94 shltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg.......skeeleetgerLakfAeelgv 174
                       +h+taNq Ileav+g       +HiiDfdi++G+QWp+L++aL  s + +  +lRiT+++  +++        +e  ++tg+rL+++Ae+lg+
  PSME_00004051-RA 262 GHFTANQCILEAVAGTecanVGIHIIDFDIMEGMQWPPLMEALKnSGEYEIDHLRITAIKWVDEDedddsllYSECCKHTGRRLSEYAETLGI 354
                       ***************95533335********************945558889*******98776677889999999***************** PP

              GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..adh.nsesFlerflealeyy 264
                       pf f+       +   l++     gE ++Vn++ ql +++  ++  + +  e+L   ++++P+ v++       d  ++++F e f+ +l+y 
  PSME_00004051-RA 355 PFLFQET-----DLKGLKDVISADGEIVIVNCMWQLPHMV--KLRNKIQLMEFLLGTRHMNPEAVTLGTGPhgNDSaEKGDFIESFAGCLKYL 440
                       *****83.....444457777888***************9..455555669****************8754213444778************* PP

              GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg..yrveee. 354
                        ++fdsle +lp++  +r++vEr+++g++ +  ++ + ++        ++  +   ++G+++ ++s++++  ak+ ++ +++ g  y+ve   
  PSME_00004051-RA 441 CTIFDSLEDGLPEHGLARAMVERMFFGPAMSRRLMRSPES------GESNVVDIAAKCGYGEGTVSDENVLYAKYTVELCSGAGrcYKVERVg 527
                       *********************************9999887......33344688999************************77777***9554 PP

              GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                       ++ lvl W   pLv+vS W+
  PSME_00004051-RA 528 QNRLVLKWACTPLVWVSTWK 547
                       999****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.489143526IPR005202Transcription factor GRAS
PfamPF035141.3E-66169547IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MQVAAGSCMQ EAAGMGSYNT WFSEQEWDHV FSNPPDGISY DIGEAEQLMD VDLDAAEWSS  60
WDDLIIDVDI NGCSVDDTSD PSLPKSFQAI EEQLMDVELQ DVNNNFQEDA VSSPRIDHEA  120
IATNSSCKSI ETDNAVSSSV DIDHAGSHEN RASKDLKTMS DVEYKGLRLL HLLTACAEAI  180
SEGAQDLAEV ILCRLRGLVS PTGSTMERVA YYLFNALVCS NNMNSIGHLE PNDRSMRITS  240
AKEHFLGALK LLHVAYPYIR IGHFTANQCI LEAVAGTECA NVGIHIIDFD IMEGMQWPPL  300
MEALKNSGEY EIDHLRITAI KWVDEDEDDD SLLYSECCKH TGRRLSEYAE TLGIPFLFQE  360
TDLKGLKDVI SADGEIVIVN CMWQLPHMVK LRNKIQLMEF LLGTRHMNPE AVTLGTGPHG  420
NDSAEKGDFI ESFAGCLKYL CTIFDSLEDG LPEHGLARAM VERMFFGPAM SRRLMRSPES  480
GESNVVDIAA KCGYGEGTVS DENVLYAKYT VELCSGAGRC YKVERVGQNR LVLKWACTPL  540
VWVSTWKSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-281695474375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.17e-52GRAS family protein